DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and Acp24A4

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster


Alignment Length:91 Identity:29/91 - (31%)
Similarity:43/91 - (47%) Gaps:16/91 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLLILASVVLYVALSSAQSCPGRPSHQNCLHGKDE--GVERARHCNRDPNPQMWYYNQRENRC 63
            ||.|::|   .:::||:|           |.|..|:|  |:..|.:.|.......|.|:.:.|.|
  Fly     1 MKLLILL---FVFIALAS-----------NSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVC 51

  Fly    64 IKMRYLGCKGNRNRYCTLNECQRKCV 89
            ....|.||:||.|.:.:..||..|||
  Fly    52 FNFIYGGCQGNENSFESQEECINKCV 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 18/58 (31%)
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 15/50 (30%)

Return to query results.
Submit another query.