powered by:
Protein Alignment CG42713 and CG31296
DIOPT Version :9
Sequence 1: | NP_001188736.1 |
Gene: | CG42713 / 10178890 |
FlyBaseID: | FBgn0261630 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262608.1 |
Gene: | CG31296 / 318668 |
FlyBaseID: | FBgn0051296 |
Length: | 280 |
Species: | Drosophila melanogaster |
Alignment Length: | 30 |
Identity: | 7/30 - (23%) |
Similarity: | 10/30 - (33%) |
Gaps: | 17/30 - (56%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 SHQNCLHGKDEGVERARHCNRDPNPQMWYY 56
:|:.|| |.|.:||
Fly 112 THKFCL-----------------NSQEFYY 124
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42713 | NP_001188736.1 |
KU |
<54..89 |
CDD:294074 |
2/3 (67%) |
CG31296 | NP_001262608.1 |
SCP_euk |
61..214 |
CDD:240180 |
7/30 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.