DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and Tfpi

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:XP_008760202.1 Gene:Tfpi / 29436 RGDID:61914 Length:306 Species:Rattus norvegicus


Alignment Length:67 Identity:21/67 - (31%)
Similarity:37/67 - (55%) Gaps:7/67 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGRPSHQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRK 87
            |.:|.|..|....::|..:|.       .:.:|:|...::|.:..|.||:||:||:.||.||::.
  Rat    45 PMKPLHTFCAMKAEDGPCKAM-------IRSYYFNMNSHQCEEFIYGGCRGNKNRFDTLEECRKT 102

  Fly    88 CV 89
            |:
  Rat   103 CI 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 17/56 (30%)
TfpiXP_008760202.1 Kunitz_TFPI1_1-like 50..104 CDD:438656 18/60 (30%)
Kunitz_TFPI1_2-like 120..175 CDD:438657
Kunitz_TFPI1_TFPI2_3-like 223..276 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.