DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and Wfdc8

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001263361.1 Gene:Wfdc8 / 277343 MGIID:2685552 Length:426 Species:Mus musculus


Alignment Length:64 Identity:17/64 - (26%)
Similarity:31/64 - (48%) Gaps:7/64 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PSHQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKCV 89
            |..:.|:...|:|       |.......||::.::::|....|.||:||.|.:.|..:|:..|:
Mouse   122 PYEEPCMLPSDKG-------NCQDILTRWYFDSQKHQCRAFLYSGCRGNANNFLTKTDCRNACM 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 15/56 (27%)
Wfdc8NP_001263361.1 WAP 79..122 CDD:459672 17/64 (27%)
Kunitz-type 127..177 CDD:438633 15/56 (27%)
WAP <180..222 CDD:238120
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.