DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and K11D12.6

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_504350.1 Gene:K11D12.6 / 187293 WormBaseID:WBGene00019646 Length:186 Species:Caenorhabditis elegans


Alignment Length:36 Identity:11/36 - (30%)
Similarity:20/36 - (55%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKCV 89
            ::|:....||:...|.||.||.|.:.....|:::|:
 Worm    38 YHYDPTVKRCLPFGYTGCGGNENNFADPRICRQRCI 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 10/33 (30%)
K11D12.6NP_504350.1 Kunitz_BPTI 18..72 CDD:425421 10/33 (30%)

Return to query results.
Submit another query.