DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and C54D10.10

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_506123.2 Gene:C54D10.10 / 183787 WormBaseID:WBGene00008304 Length:216 Species:Caenorhabditis elegans


Alignment Length:89 Identity:28/89 - (31%)
Similarity:42/89 - (47%) Gaps:14/89 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLLILASVVLYVALSSAQSCPGRPSHQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRCIK 65
            |:|:.|.   :|...:||..:.       ||...||.||    :|:..|....:|::.|.|.|..
 Worm     1 MQFISIF---LLLCCISSVSAI-------NCRQEKDTGV----NCDNKPITLKFYFDMRTNVCQP 51

  Fly    66 MRYLGCKGNRNRYCTLNECQRKCV 89
            :.|.||.||.||:.:.:.|...||
 Worm    52 LFYRGCGGNENRFESRDACSDACV 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 19/56 (34%)
C54D10.10NP_506123.2 Kunitz_BPTI 21..75 CDD:425421 19/57 (33%)
KU 158..213 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.