DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and Ambp

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_031469.1 Gene:Ambp / 11699 MGIID:88002 Length:349 Species:Mus musculus


Alignment Length:37 Identity:13/37 - (35%)
Similarity:24/37 - (64%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QMWYYNQRENRCIKMRYLGCKGNRNRYCTLNECQRKC 88
            ::|.::..:.:||:..|.|||||.|::.:..||:..|
Mouse   300 KLWAFDAAQGKCIQFHYGGCKGNGNKFYSEKECKEYC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 12/35 (34%)
AmbpNP_031469.1 lipocalin_A1M-like 27..189 CDD:381193
Kunitz_bikunin_1-like 228..281 CDD:438639
Kunitz_bikunin_2-like 284..337 CDD:438640 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.