DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42713 and si:dkeyp-73b11.8

DIOPT Version :10

Sequence 1:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001373612.1 Gene:si:dkeyp-73b11.8 / 100333708 ZFINID:ZDB-GENE-131120-176 Length:230 Species:Danio rerio


Alignment Length:69 Identity:20/69 - (28%)
Similarity:32/69 - (46%) Gaps:9/69 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QNCLHGKDE--GVERARHC--NRDPNP-----QMWYYNQRENRCIKMRYLGCKGNRNRYCTLNEC 84
            :||.|..|:  .::..:.|  .|:|..     ..:||:...:.|....:.||.||.||:.:||.|
Zfish    75 RNCSHRADQLFPMDGKQICVLPREPGQCFGHYLRYYYSPEHHTCKPFYWTGCVGNGNRFLSLNRC 139

  Fly    85 QRKC 88
            ...|
Zfish   140 NATC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 18/65 (28%)
si:dkeyp-73b11.8NP_001373612.1 Kunitz_conkunitzin 27..77 CDD:438636 0/1 (0%)
Kunitz_BPTI 92..143 CDD:425421 15/50 (30%)

Return to query results.
Submit another query.