DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42818 and CACNA2D1

DIOPT Version :9

Sequence 1:NP_001188821.1 Gene:CG42818 / 10178877 FlyBaseID:FBgn0262000 Length:1085 Species:Drosophila melanogaster
Sequence 2:XP_006716181.1 Gene:CACNA2D1 / 781 HGNCID:1399 Length:1110 Species:Homo sapiens


Alignment Length:604 Identity:118/604 - (19%)
Similarity:212/604 - (35%) Gaps:188/604 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SSKGDLDDLKYPTQLEGRHDSPKY--DKTF-------HTEIHANNETDSQELENIIL-EKNLQDS 106
            ::|.|||..|..::...:...|.:  |..|       |..:|.  .||..|...|:| |.|...:
Human   126 NAKDDLDPEKNDSEPGSQRIKPVFIEDANFGRQISYQHAAVHI--PTDIYEGSTIVLNELNWTSA 188

  Fly   107 KTE-FQENRASQPKNM-HSFQIPEAIESHF------NNKELQNENDLHKGLKQQ-YRSGSEQ--- 159
            ..| |::||...|..: ..|.....:..::      :|....|:.||:...::. |..|:..   
Human   189 LDEVFKKNREEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKD 253

  Fly   160 -----DKSGPENVREIASKLILQWAENQRSLLDSFVKAITDVLKVHDSKLNMK----------IN 209
                 |.||  :|..:..|||       |:.:...::.::|...|:.:..|..          :.
Human   254 MLILVDVSG--SVSGLTLKLI-------RTSVSEMLETLSDDDFVNVASFNSNAQDVSCFQHLVQ 309

  Fly   210 ISPRDIMILKDML-------------------KQLL----------ESIMQLREGSTSTRARIVL 245
            .:.|:..:|||.:                   :|||          :.||...:|. ..||:.:.
Human   310 ANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGG-EERAQEIF 373

  Fly   246 NKWIETQKSLIDSFSQAIQNTNQN------VDNIANVYEVME------NLNKNLREL---VILLS 295
            ||:.:.:|..:.:||....|.::.      .:|....||:..      |..:.|..|   ::|..
Human   374 NKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAG 438

  Fly   296 DKESFPTTESSSSQQTTSIYATTTFYLTSSTFG----STHPIVDENI-----NRVNIMGNLIKGL 351
            ||        :...|.|::      ||.:...|    .|.|:.  ||     |:.|:...||.|:
Human   439 DK--------AKQVQWTNV------YLDALELGLVITGTLPVF--NITGQFENKTNLKNQLILGV 487

  Fly   352 RNIMVQMDETNKTS-------SSTSYTTTESTYI------------------------------- 378
            ..:.|.:::..:.:       :...:....:.|:                               
Human   488 MGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKPIGVGIPTINLRKRRPNIQNPK 552

  Fly   379 --QPSTSTYLNAEVTTSHPTTSTYEVTN-IITDESKIKDMFNLIKGIEDLISQYNGKHKFTST-T 439
              :|.|..:|:||:...    ...|:.| :|..||..|....|:|..::   :|..|...|.| |
Human   553 SQEPVTLDFLDAELEND----IKVEIRNKMIDGESGEKTFRTLVKSQDE---RYIDKGNRTYTWT 610

  Fly   440 SLTGKSNSREPTMTTYSSAGGITSHSFTTTSPK---TVTTSSSH--STTESSPSHPTTSNYEVTV 499
            .:.|         |.||.|..:.::||.....|   |:|.:.|.  ...:|....|..       
Human   611 PVNG---------TDYSLALVLPTYSFYYIKAKLEETITQARSKKGKMKDSETLKPDN------- 659

  Fly   500 FDQDSHKFKVMKNLIKELK 518
            |::..:.|...::...:||
Human   660 FEESGYTFIAPRDYCNDLK 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42818NP_001188821.1 PHA03255 642..>763 CDD:165513
CACNA2D1XP_006716181.1 VWA_N 104..223 CDD:285584 23/98 (23%)
vWA_VGCC_like 239..417 CDD:238740 34/187 (18%)
Cache_1 446..536 CDD:280839 15/97 (15%)
VGCC_alpha2 562..646 CDD:285647 27/99 (27%)
RAMP_I_III <655..835 CDD:304371 5/31 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2353
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.