DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pre-mod(mdg4)-T and mod(mdg4)

DIOPT Version :10

Sequence 1:NP_001189255.3 Gene:pre-mod(mdg4)-T / 10178861 FlyBaseID:FBgn0261837 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_788698.1 Gene:mod(mdg4) / 49228 FlyBaseID:FBgn0002781 Length:610 Species:Drosophila melanogaster


Alignment Length:207 Identity:207/207 - (100%)
Similarity:207/207 - (100%) Gaps:0/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 ATSASATKIPPRKRGRPKTKVEDQTPKPKLLEKLQAATLNEEASEPAVYASTTKGGVKLIFNGHL 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   404 ATSASATKIPPRKRGRPKTKVEDQTPKPKLLEKLQAATLNEEASEPAVYASTTKGGVKLIFNGHL 468

  Fly    66 FKFSFRKADYSVFQCCYREHGEECKVRVVCDQKRVFPYEGEHVHFMQASDKSCLPSQFMPGESGV 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   469 FKFSFRKADYSVFQCCYREHGEECKVRVVCDQKRVFPYEGEHVHFMQASDKSCLPSQFMPGESGV 533

  Fly   131 ISSLSPSKELLMKNTTKLEEADDKEDEDFEEFEIQEIDEIELDEPEKTPAKEEEVDPNDFREKIK 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   534 ISSLSPSKELLMKNTTKLEEADDKEDEDFEEFEIQEIDEIELDEPEKTPAKEEEVDPNDFREKIK 598

  Fly   196 RRLQKALQNKKK 207
            ||||||||||||
  Fly   599 RRLQKALQNKKK 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pre-mod(mdg4)-TNP_001189255.3 FLYWCH 49..109 CDD:461332 59/59 (100%)
mod(mdg4)NP_788698.1 BTB_POZ_BAB-like 31..115 CDD:349624
FLYWCH 452..512 CDD:461332 59/59 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.