DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42846 and CG34453

DIOPT Version :9

Sequence 1:NP_001189014.1 Gene:CG42846 / 10178831 FlyBaseID:FBgn0262035 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001097458.2 Gene:CG34453 / 5740693 FlyBaseID:FBgn0085482 Length:175 Species:Drosophila melanogaster


Alignment Length:136 Identity:23/136 - (16%)
Similarity:43/136 - (31%) Gaps:42/136 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IHRAVEKSNLTAPAVHQPVLQA----------------PGFIIPYQNRSLVHANQGSHGVLPGSV 99
            :|....:|...:|.:::|:|..                ...:.|...:.:|.....:....|.:|
  Fly    62 VHNNQGESRFVSPEMYKPLLAVCRCGRTKESIHMGKCLQRALSPDYKQEMVQNGTDAWSAEPFNV 126

  Fly   100 PAQDSGPSSVWVASNNHQPGVTGVLQPNPSQGKIVNPPFVIGKNNGSFYSTYNATVPG---RTYP 161
            |:..|........|.|:|.....:        :.|:|.|               ::||   ...|
  Fly   127 PSTSSSTIGFAAISKNYQKLERSM--------QYVSPAF---------------SMPGPRITAVP 168

  Fly   162 YGNLSI 167
            |.|:.|
  Fly   169 YYNIII 174



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.