powered by:
Protein Alignment CG42846 and CG34454
DIOPT Version :9
Sequence 1: | NP_001189014.1 |
Gene: | CG42846 / 10178831 |
FlyBaseID: | FBgn0262035 |
Length: | 167 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097457.1 |
Gene: | CG34454 / 5740130 |
FlyBaseID: | FBgn0085483 |
Length: | 133 |
Species: | Drosophila melanogaster |
Alignment Length: | 56 |
Identity: | 11/56 - (19%) |
Similarity: | 18/56 - (32%) |
Gaps: | 21/56 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 SVWVASNNHQPGVTGV-LQPNPSQGKIVNPPFVIGKNNGSFYSTYNATVPGRTYPY 162
|.| |:....|.: :.|..:...:|| |..:||...|:
Fly 31 SPW----NNAAATTSIPISPTSANLVLVN----------------NVRIPGGLTPF 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42846 | NP_001189014.1 |
None |
CG34454 | NP_001097457.1 |
Surface_antigen |
29..>76 |
CDD:287966 |
11/56 (20%) |
KAZAL_FS |
78..124 |
CDD:294071 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45469562 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.