DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42846 and CG34454

DIOPT Version :9

Sequence 1:NP_001189014.1 Gene:CG42846 / 10178831 FlyBaseID:FBgn0262035 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001097457.1 Gene:CG34454 / 5740130 FlyBaseID:FBgn0085483 Length:133 Species:Drosophila melanogaster


Alignment Length:56 Identity:11/56 - (19%)
Similarity:18/56 - (32%) Gaps:21/56 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SVWVASNNHQPGVTGV-LQPNPSQGKIVNPPFVIGKNNGSFYSTYNATVPGRTYPY 162
            |.|    |:....|.: :.|..:...:||                |..:||...|:
  Fly    31 SPW----NNAAATTSIPISPTSANLVLVN----------------NVRIPGGLTPF 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42846NP_001189014.1 None
CG34454NP_001097457.1 Surface_antigen 29..>76 CDD:287966 11/56 (20%)
KAZAL_FS 78..124 CDD:294071
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.