DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42815 and Abca2

DIOPT Version :9

Sequence 1:NP_001189127.1 Gene:CG42815 / 10178812 FlyBaseID:FBgn0261997 Length:101 Species:Drosophila melanogaster
Sequence 2:XP_006233707.2 Gene:Abca2 / 79248 RGDID:620238 Length:2435 Species:Rattus norvegicus


Alignment Length:101 Identity:25/101 - (24%)
Similarity:36/101 - (35%) Gaps:25/101 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CASSGDTATKTGTGTGTGTGTGTGTGTGTAT-----TSTTVAPTTTSTTTAEATV---------- 71
            ||... .|.:.|:.:|....||.|..||..|     |.:.|.|.:..|...:.:.          
  Rat   352 CAGRA-PAPQAGSPSGPANSTGVGANTGPNTTVEEGTQSPVTPASPDTLQGQCSAFVQLWAGLQP 415

  Fly    72 ----HHRRIHRR--RRRNLRRLRHRRAEAERRRRLG 101
                ::|.|...  ||.|:..|.....|   :|.||
  Rat   416 ILCGNNRTIEPEALRRGNMSSLGFTSKE---QRNLG 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42815NP_001189127.1 None
Abca2XP_006233707.2 rim_protein 1..2369 CDD:130324 25/101 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.