powered by:
Protein Alignment CG42815 and Abca14
DIOPT Version :9
Sequence 1: | NP_001189127.1 |
Gene: | CG42815 / 10178812 |
FlyBaseID: | FBgn0261997 |
Length: | 101 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017167760.1 |
Gene: | Abca14 / 67928 |
MGIID: | 2388708 |
Length: | 1719 |
Species: | Mus musculus |
Alignment Length: | 44 |
Identity: | 15/44 - (34%) |
Similarity: | 19/44 - (43%) |
Gaps: | 8/44 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 LPLTLAV----IAIC---CMSFIECASSGDTAT-KTGTGTGTGT 40
:|.|||| :||. |...:....:|.|.| |..||....|
Mouse 1405 IPPTLAVRNISVAIQKEECFGLLGLNGAGKTTTFKILTGEEIAT 1448
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42815 | NP_001189127.1 |
None |
Abca14 | XP_017167760.1 |
rim_protein |
<128..1709 |
CDD:130324 |
15/44 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0059 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.