DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42815 and ABCA

DIOPT Version :9

Sequence 1:NP_001189127.1 Gene:CG42815 / 10178812 FlyBaseID:FBgn0261997 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_608445.2 Gene:ABCA / 33103 FlyBaseID:FBgn0031170 Length:1714 Species:Drosophila melanogaster


Alignment Length:79 Identity:19/79 - (24%)
Similarity:28/79 - (35%) Gaps:12/79 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SGDTAT---KTG-----TGTGTGTGTGTGTGTGTATTSTTVAPTTTSTTTAEATVHHRRIHRRRR 81
            :|.|.|   .||     :||....|:...|....|..|..:.|.........:..:|.|...|  
  Fly   574 AGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSR-- 636

  Fly    82 RNLRRLRHRRAEAE 95
              ::.||.:..|.|
  Fly   637 --MKGLRGKAVEQE 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42815NP_001189127.1 None
ABCANP_608445.2 ABC2_membrane_4 254..434 CDD:289500
ABC2_membrane_3 <269..475 CDD:289468
CcmA 538..843 CDD:224054 19/79 (24%)
ABC_subfamily_A 538..755 CDD:213230 19/79 (24%)
ABC2_membrane_3 913..1316 CDD:289468
ABC_subfamily_A 1369..1587 CDD:213230
drrA 1376..1702 CDD:130256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.