DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42815 and Abca6

DIOPT Version :9

Sequence 1:NP_001189127.1 Gene:CG42815 / 10178812 FlyBaseID:FBgn0261997 Length:101 Species:Drosophila melanogaster
Sequence 2:XP_006247716.1 Gene:Abca6 / 303639 RGDID:1308998 Length:1630 Species:Rattus norvegicus


Alignment Length:41 Identity:12/41 - (29%)
Similarity:20/41 - (48%) Gaps:2/41 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VAPTTTSTTTAEATVHHRRIHRRRRRNLRRLRHRRAEAERR 97
            |||  .|.:.|:.|:....:.|.:...:.|||..:...||:
  Rat   819 VAP--PSLSKAQKTMSAMSLWRMQVCAIARLRVLKLRRERK 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42815NP_001189127.1 None
Abca6XP_006247716.1 ABC2_membrane_3 35..420 CDD:289468
ABC2_membrane_4 220..409 CDD:289500
CcmA 480..795 CDD:224054
ABC_subfamily_A 482..705 CDD:213230
ABC2_membrane_3 859..1171 CDD:289468
ABC2_membrane_4 1007..1178 CDD:289500
CcmA 1279..1605 CDD:224054
ABC_subfamily_A 1300..1514 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.