DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42815 and Abca7

DIOPT Version :9

Sequence 1:NP_001189127.1 Gene:CG42815 / 10178812 FlyBaseID:FBgn0261997 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_997481.1 Gene:Abca7 / 299609 RGDID:1303134 Length:2170 Species:Rattus norvegicus


Alignment Length:37 Identity:13/37 - (35%)
Similarity:18/37 - (48%) Gaps:1/37 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GTATTSTTVAPTTTSTTTAEATVHHR-RIHRRRRRNL 84
            |:|.|:..|...|.:.....|.:|.| .:.||.||.|
  Rat  1217 GSAPTTAQVQGWTLTCQQLRALLHKRFLLARRSRRGL 1253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42815NP_001189127.1 None
Abca7NP_997481.1 rim_protein 1..2127 CDD:130324 13/37 (35%)
ABC2_membrane <557..742 CDD:304374
ABC_subfamily_A 805..1024 CDD:213230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1044..1086
ABC_subfamily_A 1818..2038 CDD:213230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2129..2170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.