DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42815 and Abca15

DIOPT Version :9

Sequence 1:NP_001189127.1 Gene:CG42815 / 10178812 FlyBaseID:FBgn0261997 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001099763.2 Gene:Abca15 / 293442 RGDID:1305981 Length:1668 Species:Rattus norvegicus


Alignment Length:39 Identity:13/39 - (33%)
Similarity:18/39 - (46%) Gaps:3/39 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GTGTATTSTTVAPTTTSTTTAEATVHHRRI--HRRRRRN 83
            |.|.:|| .::.......|:.||.||...|  |..:.||
  Rat   561 GAGKSTT-LSILSGLYPPTSGEAYVHGEDISQHMDQIRN 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42815NP_001189127.1 None
Abca15NP_001099763.2 ABC2_membrane_3 <255..464 CDD:289468
CcmA 522..834 CDD:224054 13/39 (33%)
ABC_subfamily_A 522..743 CDD:213230 13/39 (33%)
ABC2_membrane_3 <1007..1195 CDD:289468
ABC_subfamily_A 1354..1575 CDD:213230
drrA 1369..1662 CDD:130256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.