DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42815 and Abca13

DIOPT Version :9

Sequence 1:NP_001189127.1 Gene:CG42815 / 10178812 FlyBaseID:FBgn0261997 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_839990.2 Gene:Abca13 / 268379 MGIID:2388707 Length:5034 Species:Mus musculus


Alignment Length:71 Identity:21/71 - (29%)
Similarity:24/71 - (33%) Gaps:10/71 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AIC-CMSFIECA-SSG------DTATKTGTGTGTGTGTGTGTGTGTATTSTTVAPTTTSTTTAEA 69
            :|| .|....|: |||      |...| |.....|.|...|...|.|..|.|...........|.
Mouse  3766 SICGLMERRRCSLSSGLFFFNEDFGNK-GLSQQNGPGEMEGGNPGVALISVTKEYEDHKVAVQEL 3829

  Fly    70 TV-HHR 74
            |: .||
Mouse  3830 TLTFHR 3835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42815NP_001189127.1 None
Abca13NP_839990.2 rim_protein 3036..5019 CDD:130324 21/71 (30%)
ABC_subfamily_A 3815..4030 CDD:213230 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 4135..4165
ABC_subfamily_A 4692..4919 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.