DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42815 and ABCA12

DIOPT Version :9

Sequence 1:NP_001189127.1 Gene:CG42815 / 10178812 FlyBaseID:FBgn0261997 Length:101 Species:Drosophila melanogaster
Sequence 2:XP_011509253.1 Gene:ABCA12 / 26154 HGNCID:14637 Length:2598 Species:Homo sapiens


Alignment Length:40 Identity:9/40 - (22%)
Similarity:16/40 - (40%) Gaps:2/40 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TGTGTGTGTGTGTATTSTTVAPTTTSTTTAEATVHHRRIH 77
            |..|.||...:..:.....::|:...  |:|.|..:...|
Human  1763 TAMGLGTLRNSSNSYPEIQISPSLYG--TSEQTAFYANYH 1800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42815NP_001189127.1 None
ABCA12XP_011509253.1 ABC2_membrane_3 <1026..1270 CDD:289468
ZnuC 1349..1573 CDD:224046
ABC_subfamily_A 1353..1568 CDD:213230
ABC2_membrane_3 <1916..2177 CDD:289468
ABC_subfamily_A 2257..2480 CDD:213230
CcmA 2262..2570 CDD:224054
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.