DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42815 and Abca16

DIOPT Version :9

Sequence 1:NP_001189127.1 Gene:CG42815 / 10178812 FlyBaseID:FBgn0261997 Length:101 Species:Drosophila melanogaster
Sequence 2:XP_006507746.1 Gene:Abca16 / 233810 MGIID:2388711 Length:1679 Species:Mus musculus


Alignment Length:89 Identity:23/89 - (25%)
Similarity:34/89 - (38%) Gaps:14/89 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLLPLTLAVIAICCMSFIECASSGDTAT-KTGTGTGTGTGTGTGTGTGTATTSTT-------- 56
            :|.:..::|.|....|...:....:|.|.| |..||..|.| :|.....|.:.|.|.        
Mouse  1368 VKAVKNISLVVKKSECFGLLGLNGAGKTTTFKMLTGEETIT-SGIAFIDGNSVTRTPRKIRSRIG 1431

  Fly    57 VAPTTTST----TTAEATVHHRRI 76
            ..|.|.|.    |..|:.|.:.|:
Mouse  1432 YCPQTESVLNHMTGRESLVMYARL 1455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42815NP_001189127.1 None
Abca16XP_006507746.1 rim_protein <196..1665 CDD:130324 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.