powered by:
Protein Alignment CG42815 and ABCA2
DIOPT Version :9
Sequence 1: | NP_001189127.1 |
Gene: | CG42815 / 10178812 |
FlyBaseID: | FBgn0261997 |
Length: | 101 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_997698.1 |
Gene: | ABCA2 / 20 |
HGNCID: | 32 |
Length: | 2466 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 18/69 - (26%) |
Similarity: | 26/69 - (37%) |
Gaps: | 15/69 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKLLLPLTLAVIAICCMSFIECASSGDTATKTGTGT-GTGTGTGTGTGTGTATTSTTVAPTTTST 64
:.|||| :.|.:|.|.....:|. |...|||.|...|...|:...||:..:.
Human 373 LALLLP--------------QGACTGRTPGPPASGAGGAANGTGAGAVMGPNATAEEGAPSAAAL 423
Fly 65 TTAE 68
.|.:
Human 424 ATPD 427
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0059 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.