DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42815 and abca1b

DIOPT Version :9

Sequence 1:NP_001189127.1 Gene:CG42815 / 10178812 FlyBaseID:FBgn0261997 Length:101 Species:Drosophila melanogaster
Sequence 2:XP_005173137.1 Gene:abca1b / 100136868 ZFINID:ZDB-GENE-030131-9826 Length:2282 Species:Danio rerio


Alignment Length:45 Identity:11/45 - (24%)
Similarity:22/45 - (48%) Gaps:5/45 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSFIECASSGDTATKTGTGTGTGTG--TGTGTGTGTATTSTTVAP 59
            :||::   ..|.|:::.:..|.|:.  :...|..||:...:.|.|
Zfish  1151 VSFVK---KDDNASESSSDAGLGSDQESEAATAIGTSWPESPVVP 1192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42815NP_001189127.1 None
abca1bXP_005173137.1 rim_protein 1..2242 CDD:130324 11/45 (24%)
ABC_subfamily_A 902..1121 CDD:213230
ABC_subfamily_A 1932..2152 CDD:213230
DUF4162 2146..2238 CDD:290451
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.