DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and PRY2

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:50/196 - (25%)
Similarity:75/196 - (38%) Gaps:49/196 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWN 96
            ||....|:...|..||....:|          :::..||..|       |..|.|    ..:.|:
Yeast   173 TTATTTQSTASSTQSSSSDFST----------SMVNEHNTKR-------ALHKDT----GSLTWS 216

  Fly    97 KDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWA 161
            ..|...|...|.:.....:..|:...:   |:|| |:|:....                :|..|.
Yeast   217 DTLATYAQNYADSYDCSGNLVHSGGPY---GENL-ALGYGTTG----------------SVDAWY 261

  Fly   162 GEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGLVAYNLGEIRRYNLACNY-AYTNVIG 225
            .|   ||:.|.  :.|...|..||.|.::.:.::.|||||.:.. ||...| :.|:| |..||||
Yeast   262 NE---ITSYDY--SNPGFSESAGHFTQVVWKGTSEVGCGLKSCG-GEWGDY-IICSYKAAGNVIG 319

  Fly   226 E 226
            |
Yeast   320 E 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 37/157 (24%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 41/175 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344562
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.