DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and PRY3

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:104 Identity:25/104 - (24%)
Similarity:38/104 - (36%) Gaps:31/104 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLIN 191
            |:|| |:|::...                ||..|.||     ......:.|...|..||.|.::.
Yeast    77 GENL-ALGYTDTG----------------AVDAWYGE-----ISKYNYSNPGFSESTGHFTQVVW 119

  Fly   192 EKSNAVGCGL----VAYNLGEIRRYNLACNYAYTNVIGE 226
            :.:..:|||.    ..:|...:..||...||     :||
Yeast   120 KSTAEIGCGYKYCGTTWNNYIVCSYNPPGNY-----LGE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 22/95 (23%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 23/101 (23%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344583
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.