Sequence 1: | NP_001284979.1 | Gene: | CG42780 / 10178796 | FlyBaseID: | FBgn0261848 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_113664.1 | Gene: | CRISPLD2 / 83716 | HGNCID: | 25248 | Length: | 497 | Species: | Homo sapiens |
Alignment Length: | 221 | Identity: | 57/221 - (25%) |
---|---|---|---|
Similarity: | 79/221 - (35%) | Gaps: | 65/221 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 DKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRL 125
Fly 126 SGQNLFA-------MGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPE-- 181
Fly 182 ---VIGHLTVLINEKSNAVGCGLVAYNL-------GEI--RRYNLACNYA-YTNVIGERVYE--- 230
Fly 231 ---ECAKA-GIECAKGI---DQKYPP 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42780 | NP_001284979.1 | SCP_euk | 62..219 | CDD:240180 | 44/177 (25%) |
CRISPLD2 | NP_113664.1 | SCP_euk | 56..201 | CDD:240180 | 44/177 (25%) |
LCCL | 286..370 | CDD:128866 | |||
LCCL | 387..479 | CDD:128866 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165151223 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.850 |