DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CRISPLD1

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:265 Identity:65/265 - (24%)
Similarity:96/265 - (36%) Gaps:73/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLHSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNLVRQKWAS 78
            :|..|.|.:..:|    |...||.|.     |.....|        .|..:::..||.:|     
Human    31 LLEKLLEKYMDED----GEWWIAKQR-----GKRAITD--------NDMQSILDLHNKLR----- 73

  Fly    79 GKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHARITKT 143
              :::..||..|..|.|:.:||:.|...|::||..|.........   ||||   |....|....
Human    74 --SQVYPTASNMEYMTWDVELERSAESWAESCLWEHGPASLLPSI---GQNL---GAHWGRYRPP 130

  Fly   144 KMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPP-----EVIGHLTVLINEKSNAVGCGL-V 202
            ..:          ||.|..|.||.:.....:..|..|     .|..|.|.::...||.:||.: :
Human   131 TFH----------VQSWYDEVKDFSYPYEHECNPYCPFRCSGPVCTHYTQVVWATSNRIGCAINL 185

  Fly   203 AYNL---GEI--RRYNLACNYA-YTNVIGERVYEECAKAGIECA-----------------KGID 244
            .:|:   |:|  :...|.|||: ..|..|...|    |.|..|:                 :|.|
Human   186 CHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPY----KHGRPCSACPPSFGGGCRENLCYKEGSD 246

  Fly   245 QKYPP 249
            :.|||
Human   247 RYYPP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 42/167 (25%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180 42/166 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281
LCCL 291..375 CDD:128866
LCCL 392..483 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.