DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and AT5G57625

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_680450.1 Gene:AT5G57625 / 835867 AraportID:AT5G57625 Length:207 Species:Arabidopsis thaliana


Alignment Length:240 Identity:47/240 - (19%)
Similarity:76/240 - (31%) Gaps:55/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFTFNIFVLSLVLHSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDA----TVIKLNLGD-K 62
            |..|.|.:|.:...::..::.||......|.::  ........|..||..    |...|..|. .
plant    10 VIVFTISLLLVAFQAVHADYYRQRPPVTPTPYV--PKPRYPLPSPSPKPVYRPPTTPSLPAGSIA 72

  Fly    63 NALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSG 127
            ...:..||.:|.  ..|...:.|.....:...|..:..:.             :|..|......|
plant    73 RLFLDPHNALRS--GLGLPPLIWDGKLASYATWWANQRRY-------------DCSLTHSTGPYG 122

  Fly   128 QNLF-------AMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGH 185
            :|||       |.||                    |||.|..|.:   :.:....:.:...:.||
plant   123 ENLFWGSGSSWAPGF--------------------AVQSWIVEGR---SYNHNTNSCDGSGMCGH 164

  Fly   186 LTVLINEKSNAVGCGLVAYNLGEIRRYNLACNY-AYTNVIGERVY 229
            .|.::...:..:||..|....|  ....:.||| ...|.:||:.|
plant   165 YTQMVWRDTKRLGCARVVCENG--AGVFITCNYDPPGNYVGEKPY 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 30/164 (18%)
AT5G57625NP_680450.1 CAP_PR-1 72..207 CDD:349400 33/174 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.