DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and AT4G33720

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_195098.1 Gene:AT4G33720 / 829514 AraportID:AT4G33720 Length:163 Species:Arabidopsis thaliana


Alignment Length:233 Identity:46/233 - (19%)
Similarity:74/233 - (31%) Gaps:83/233 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVFTFNIFVLSLVLHSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALI 66
            ::|....|.|.|::|..|::                          .|:|             .:
plant     9 NLFLAITFFLVLIVHLKAQD--------------------------SPQD-------------FL 34

  Fly    67 KAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDEC---HNTEKFRLSGQ 128
            ..||..|.:  .|...::|.             ||:|............:|   |::..:   |:
plant    35 AVHNRARAE--VGVGPLRWD-------------EKVAAYARNYANQRKGDCAMKHSSGSY---GE 81

  Fly   129 NL-FAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINE 192
            |: ::.|               ||....||..|..|:.|.   |....|....:..||.|.::..
plant    82 NIAWSSG---------------SMTGVAAVDMWVDEQFDY---DYDSNTCAWDKQCGHYTQVVWR 128

  Fly   193 KSNAVGCGLVAYNLGEIRRYNLACNY-AYTNVIGERVY 229
            .|..:||..|..|.|:.   .:.||| ...|.:||..|
plant   129 NSERLGCAKVRCNNGQT---FITCNYDPPGNWVGEWPY 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 34/161 (21%)
AT4G33720NP_195098.1 CAP_PR-1 30..163 CDD:349400 39/184 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.