DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and AT4G33710

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_195097.1 Gene:AT4G33710 / 829513 AraportID:AT4G33710 Length:166 Species:Arabidopsis thaliana


Alignment Length:188 Identity:44/188 - (23%)
Similarity:67/188 - (35%) Gaps:51/188 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ATVIKLNLGDKNA-LIKAHNLVRQ-------KWASGKAKIKWTACKMAKMEWNKDLEKLAILNAK 108
            |..:.|...|:.. .:..||..|.       ||.:|.|:..|...:..|               :
plant    20 AFAVPLKAQDRRQDYLDVHNHARDDVSVPHIKWHAGAARYAWNYAQRRK---------------R 69

  Fly   109 TCLMGHDECHNTEKFRLSGQNL-FAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDL 172
            .|.:    .|:..:.|. |:|| ::.|               .|....||:.|..|:.|...   
plant    70 DCRL----IHSNSRGRY-GENLAWSSG---------------DMSGAAAVRLWVREKSDYFH--- 111

  Fly   173 KKTTPNPPEVIGHLTVLINEKSNAVGCGLVAYNLGEIRRYNLACNYAYT-NVIGERVY 229
            |..|....:..||.|.::.:.|..|||..|..:.|..   .:.|||::. ||.|.|.|
plant   112 KSNTCRAGKQCGHYTQVVWKNSEWVGCAKVKCDNGGT---FVTCNYSHPGNVRGRRPY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 35/165 (21%)
AT4G33710NP_195097.1 CAP_PR-1 32..166 CDD:349400 40/174 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.