DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and AT4G31470

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_194875.1 Gene:AT4G31470 / 829274 AraportID:AT4G31470 Length:185 Species:Arabidopsis thaliana


Alignment Length:242 Identity:50/242 - (20%)
Similarity:77/242 - (31%) Gaps:84/242 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFTFNIFVLSLVLHSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNAL-- 65
            :|...|.|:|..|.||                        ||.....:..|...|......||  
plant     7 IFIIIIIVISTPLPSL------------------------SFQIPSNRTPTTSTLIFSQDKALAR 47

  Fly    66 -------IKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKF 123
                   ::.||::|.|            .::..::|:..|...|...|:|   ...:|......
plant    48 NTIQQQFLRPHNILRAK------------LRLPPLKWSNSLALYASRWART---RRGDCKLIHSG 97

  Fly   124 RLSGQNLF---AMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEK--DITAEDLKKTTPNPPEVI 183
            ...|:|||   ..|::.                ..||..||.|.|  |......|..        
plant    98 GPYGENLFWGSGKGWTP----------------RDAVAAWASEMKYYDRRTSHCKAN-------- 138

  Fly   184 G---HLTVLINEKSNAVGCGLVAYNLGEIRRYNLACNY-AYTNVIGE 226
            |   |.|.|:.:||:.:||.:.....|:.   .:.||| ...|::|:
plant   139 GDCLHYTQLVWKKSSRIGCAISFCKTGDT---FIICNYDPPGNIVGQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 37/174 (21%)
AT4G31470NP_194875.1 CAP_PR-1 51..185 CDD:349400 37/174 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.