DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and AT4G25790

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_194309.1 Gene:AT4G25790 / 828684 AraportID:AT4G25790 Length:210 Species:Arabidopsis thaliana


Alignment Length:115 Identity:30/115 - (26%)
Similarity:45/115 - (39%) Gaps:19/115 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPP 180
            :|..|......|:||| .| |.:..|.|           .||:.|..|.|   :.:....|....
plant   114 DCSLTHSTGPYGENLF-WG-SGSDFTST-----------FAVESWTVEAK---SYNHMTNTCEGD 162

  Fly   181 EVIGHLTVLINEKSNAVGCGLVAYNLGEIRRYNLACNY-AYTNVIGERVY 229
            .:.||.|.::..::..:||..|....|  ....:.||| ...|.:||:.|
plant   163 GMCGHYTQIVWRETRRLGCARVVCENG--AGVFITCNYDPPGNYVGEKPY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 26/103 (25%)
AT4G25790NP_194309.1 CAP_PR-1 76..210 CDD:349400 29/113 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.