DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and AT3G19690

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:238 Identity:49/238 - (20%)
Similarity:80/238 - (33%) Gaps:86/238 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVFTFNI-FVLSLVLH--SLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDK 62
            ||:...|| |:|::.|.  ||||:..:|                                     
plant     1 MSLLKTNILFLLAIALFYGSLAEDLQQQ------------------------------------- 28

  Fly    63 NALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDEC---HNTEKFR 124
              .::|||..|.:            ..:..:.|:.::...|...|...:   ::|   |:...| 
plant    29 --FLEAHNEARNE------------VGLDPLVWDDEVAAYAASYANQRI---NDCALVHSNGPF- 75

  Fly   125 LSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPE--VIGHLT 187
              |:|: ||...             .|..|.|.:.|..|::   ..|....|.|.|.  ...|.|
plant    76 --GENI-AMSSG-------------EMSAEDAAEMWINEKQ---YYDYDSNTCNDPNGGTCLHYT 121

  Fly   188 VLINEKSNAVGCGLVAYNLGEIRRYNLACNY-AYTNVIGERVY 229
            .::.:.:..:||..|..|.|..   .:.||| ...|.|||:.:
plant   122 QVVWKNTVRLGCAKVVCNSGGT---FITCNYDPPGNYIGEKPF 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 33/162 (20%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 38/211 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.