DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and PRB1

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:168 Identity:39/168 - (23%)
Similarity:58/168 - (34%) Gaps:38/168 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ATVIKLNLGD-KNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHD 115
            |.|:.|...| :...:.|||..|.:...|            .|:|::.|...| .|....|.|  
plant    19 ALVVPLKAQDSQQDYVNAHNQARSQIGVG------------PMQWDEGLAAYA-RNYANQLKG-- 68

  Fly   116 ECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPP 180
            :|.........|:||...|...:.:.              ||..|..|:.:...:     |....
plant    69 DCRLVHSRGPYGENLAKSGGDLSGVA--------------AVNLWVNEKANYNYD-----TNTCN 114

  Fly   181 EVIGHLTVLINEKSNAVGCGLVAYNLGEIRRYNLACNY 218
            .|.||.|.::...|..:||..|..|.|..   .::|||
plant   115 GVCGHYTQVVWRNSVRLGCAKVRCNNGGT---IISCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 35/157 (22%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 35/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.