DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and Glipr1

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_006514280.1 Gene:Glipr1 / 73690 MGIID:1920940 Length:270 Species:Mus musculus


Alignment Length:216 Identity:47/216 - (21%)
Similarity:78/216 - (36%) Gaps:42/216 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NGSFGSSCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAIL 105
            :.||.:|...|.|    |.......::.||.:|       :|:...|..|..|.|:..|.::|..
Mouse    17 SSSFTASTLPDIT----NEDFIKECVQVHNQLR-------SKVSPPARNMLYMSWDPKLAQIAKA 70

  Fly   106 NAKTCLMGHD-ECHNT--EKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEK-- 165
            ..|:|...|: :.|:.  ..|...|:|::....|...::.             |:..|..|.|  
Mouse    71 WTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSS-------------AISAWYEEIKHY 122

  Fly   166 DITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGLVAYNLGEIRRYNLACNYAYTNVIGERVYE 230
            |.:....:       .|.||.|.::...|..:||.:.....|.    |..|:|..........|:
Mouse   123 DFSTRKCR-------HVCGHYTQVVWADSYKLGCAVQLCPNGA----NFICDYGPAGNYPTWPYK 176

  Fly   231 ECAKAGIECAKGIDQKYPPLC 251
            :.|... :|.|. |:....||
Mouse   177 QGATCS-DCPKD-DKCLNSLC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 33/161 (20%)
Glipr1XP_006514280.1 CAP_GLIPR1-like 32..168 CDD:349404 34/166 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.