DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CRISP2

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:236 Identity:47/236 - (19%)
Similarity:82/236 - (34%) Gaps:65/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMG 113
            |....::...|..:..::..||.:|:       .:...|..|.||||::::...|...|..|.:.
Human    24 PAFTALLTTQLQVQREIVNKHNELRK-------AVSPPASNMLKMEWSREVTTNAQRWANKCTLQ 81

  Fly   114 HDECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPN 178
            |.:..:.:.....|:||:......:              :..|:|.|..|..|.......|   :
Human    82 HSDPEDRKTSTRCGENLYMSSDPTS--------------WSSAIQSWYDEILDFVYGVGPK---S 129

  Fly   179 PPEVIGHLTVLINEKSNAVGCGLVAYNLGEIRRYNLACNY-----AYTN---------------- 222
            |..|:||.|.|:...:..||||:......:..:|...|.|     .|.|                
Human   130 PNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAMKTYLNKREGINVWKCFLRLRH 194

  Fly   223 ---VIGERV--------------YEE---CAKAGIECAKGI 243
               :.||::              |::   ||....:|.||:
Human   195 FQLLRGEQLLTFSGNNMNRKNTPYQQGTPCAGCPDDCDKGL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 35/161 (22%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 35/160 (22%)
Crisp 224..278 CDD:285731 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151286
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.