DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:240 Identity:54/240 - (22%)
Similarity:92/240 - (38%) Gaps:60/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FVLSLVLHSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNLVR 73
            |:.:|||:.:|....:                  :||...|:..|:......|  |.:..||.:|
Mouse     9 FLWTLVLYLIASRLPK------------------AFGKDLPRVPTITDPKFID--AFLNIHNELR 53

  Fly    74 QKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDEC-----HNTEKFRLSGQNLFAM 133
            :       |::..|..|.::.|::.|.|||....:.|.:.|:.|     ...|.:...|:|::. 
Mouse    54 R-------KVQPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFIGENIYL- 110

  Fly   134 GFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVG 198
                .||....         |..|..|..|.|.... |....:    |:.||.|.::..|:..:|
Mouse   111 ----GRIETQP---------EDVVINWYNESKYFNF-DFNTCS----EMCGHYTQVVWAKTVKIG 157

  Fly   199 CGLVAYNLGEIRRYN---LACNYAYT-NVIGERVY---EECAKAG 236
            |.:  .|...::.::   ..|||:.. |.||.|.|   :.|:..|
Mouse   158 CAV--SNCPNLKGFSAGLFVCNYSPAGNFIGFRPYTRGDSCSMCG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 36/164 (22%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 38/170 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841398
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.