DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and Glipr2

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_006238202.1 Gene:Glipr2 / 679819 RGDID:1583669 Length:170 Species:Rattus norvegicus


Alignment Length:176 Identity:39/176 - (22%)
Similarity:63/176 - (35%) Gaps:46/176 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLA---ILNAKTCLMGHDECHNTEKFR 124
            |.::||||..|.|......|:    ||....|..:..|.||   ||.           |:.|..|
  Rat    27 NEVLKAHNEYRAKHGVPPLKL----CKKLNQEAQQYSEALASTRILK-----------HSPESSR 76

  Fly   125 -LSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTV 188
             ..|:||     :.|...:|...:         ..:|..|.|....:.     |......||.|.
  Rat    77 GQCGENL-----AWASYDQTGKEV---------ADRWYSEIKSYNFQQ-----PGFTSGTGHFTA 122

  Fly   189 LINEKSNAVGCGLVAYNLGE---IRRYNLACNYAYTNVIGERVYEE 231
            ::.:.:..:|.|..:.:.|.   :.||     :...|::.:..:||
  Rat   123 MVWKNTKKIGVGKASASDGSSFVVARY-----FPAGNIVNQGFFEE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 36/162 (22%)
Glipr2XP_006238202.1 SCP_GAPR-1_like 24..155 CDD:240182 36/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.