DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and Crisp1

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001034482.2 Gene:Crisp1 / 654517 RGDID:1590757 Length:254 Species:Rattus norvegicus


Alignment Length:246 Identity:42/246 - (17%)
Similarity:79/246 - (32%) Gaps:55/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TFNIFVLSLVL-HSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKA 68
            |..:||..:.| |...:......|.|:..|.              |::..|...|...:|....|
  Rat    14 TLTVFVPVVTLRHLKLDRALYNQLITESQTE--------------PQEEIVDTHNAFRRNVSPPA 64

  Fly    69 HNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAM 133
            .|:::..|:|..|:......:......:..||:.  |....|    .|..:.|.:..|..|:..:
  Rat    65 RNMLKMSWSSAAAENARILARYCDKSDSDSLERR--LPNTFC----GENMHMENYPSSWSNVIEI 123

  Fly   134 GFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVG 198
            .::.::..|              ..:|...:.||...              |.|.::...|..:|
  Rat   124 WYNESKYFK--------------YGEWPSTDDDIETY--------------HYTQMVWASSYLIG 160

  Fly   199 CGLVAYNLGEIRRYNLACNYAYTNVIGERV---YEE---CAKAGIECAKGI 243
            |.:.:....:...|...|:|.:.....:.:   |:|   |......|..|:
  Rat   161 CDVASCRRQKAATYLYVCHYCHEGNSQDTLNMPYKEGPPCQDCPNNCEDGL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 25/156 (16%)
Crisp1NP_001034482.2 SCP 46..182 CDD:294090 28/169 (17%)
Crisp 200..254 CDD:285731 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344739
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.