DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and Crisp3

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:209 Identity:45/209 - (21%)
Similarity:81/209 - (38%) Gaps:51/209 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAK----TC 110
            ::.:..||::.::  :|..||.:|:       .:..:...:.::||:.|    |.:||:    .|
  Rat    31 ENLSTTKLSVQEE--IINKHNQLRR-------TVSPSGSDLLRVEWDHD----AYVNAQKWANRC 82

  Fly   111 LMGHDEC-HNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKK 174
            :..|... |.|...: .|:|||...:..:              :...:|.|..|..|.....   
  Rat    83 IYNHSPLQHRTTTLK-CGENLFMANYPAS--------------WSSVIQDWYDESLDFVFGF--- 129

  Fly   175 TTPNPPEV---IGHLTVLINEKSNAVGCGLVAYNLGEIRRYNLACNYA-YTNVIGERVY------ 229
               .|.:|   :||.|.::...:..|.|| ||....:..:|...|:|. ..|.:| |:|      
  Rat   130 ---GPKKVGVKVGHYTQVVWNSTFLVACG-VAECPDQPLKYFYVCHYCPGGNYVG-RLYSPYTEG 189

  Fly   230 EECAKAGIECAKGI 243
            |.|......|..|:
  Rat   190 EPCDSCPGNCEDGL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 34/164 (21%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 35/169 (21%)
Crisp 192..246 CDD:285731 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.