DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and crispld2

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:273 Identity:71/273 - (26%)
Similarity:102/273 - (37%) Gaps:70/273 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FVLSLVLHSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNLVR 73
            ::|||.|..|.:..|   .|.........:|:...:..:.|...|...:...||..:|:.||.:|
 Frog     7 WILSLGLFFLLKEQC---YCIFAPNSTFLENLLNKYKDTTPHSRTRRAILRTDKEEIIQLHNKLR 68

  Fly    74 QKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHA 138
                   .::..:|..|..|.|:.:|||.|...|:.|:..|..   |......|||| |:.:...
 Frog    69 -------GQVHPSASNMEYMTWDDELEKSAEAWAEECIWEHGP---TALLMSIGQNL-AVHWGRY 122

  Fly   139 RITKTKMNMTLSMLFEMA--VQKWAGEEKDITAEDLKKTTPNPPE-----VIGHLTVLINEKSNA 196
            |              :.|  ||.|..|.||.|.....:..|..||     :..|.|.::...:..
 Frog   123 R--------------QPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTK 173

  Fly   197 VGCGLVAYNLGEIRRYN-----------LACNYA-YTNVIGERVYEECAKAGIECAKGIDQKYPP 249
            |||   |.|:  .:|.|           |.|||: ..|.|||..|    |.|..|:     :.||
 Frog   174 VGC---AVNV--CKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPY----KNGRPCS-----ECPP 224

  Fly   250 ---------LCAK 253
                     ||.|
 Frog   225 SYGGNCQNNLCYK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 46/174 (26%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180 46/174 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281
LCCL 289..373 CDD:128866
LCCL 392..490 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.