Sequence 1: | NP_001284979.1 | Gene: | CG42780 / 10178796 | FlyBaseID: | FBgn0261848 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025526.1 | Gene: | crispl / 594930 | XenbaseID: | XB-GENE-5768874 | Length: | 314 | Species: | Xenopus tropicalis |
Alignment Length: | 201 | Identity: | 41/201 - (20%) |
---|---|---|---|
Similarity: | 71/201 - (35%) | Gaps: | 53/201 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 DKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRL 125
Fly 126 -----SGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEV--- 182
Fly 183 IGHLTVLINEKSNAVGCG-----LVAYNLGEIRRYNLACNYA----YTNV-IGERVYEECAKAGI 237
Fly 238 ECAKGI 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42780 | NP_001284979.1 | SCP_euk | 62..219 | CDD:240180 | 32/169 (19%) |
crispl | NP_001025526.1 | CAP_CRISP | 106..245 | CDD:349402 | 34/172 (20%) |
Crisp | 261..314 | CDD:369954 | 3/12 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |