DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and pi15a

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:207 Identity:56/207 - (27%)
Similarity:80/207 - (38%) Gaps:39/207 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SSCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTC 110
            ::.||......::..|..|::..||.||       .|:...|..|..|.|:..|.|.|...|.||
Zfish    53 ANIPKTRRKRYISQNDMLAILDYHNKVR-------GKVFPPASNMEYMVWDDTLAKTAEQWASTC 110

  Fly   111 LMGHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKT 175
            :..|..   ....|..||||           ..:.....|:|  ..|:.|..|.||.:....:..
Zfish   111 IWEHGP---RNLLRFLGQNL-----------SVRTGRYRSIL--QLVKPWHDEVKDYSFPYPRDC 159

  Fly   176 TPNPP-----EVIGHLTVLINEKSNAVGCGL-VAYNL---GEI--RRYNLACNYA-YTNVIGERV 228
            .|..|     .:..|.|.::...||.|||.: ..:|:   |.:  |...|.|||: ..|.|||..
Zfish   160 NPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAP 224

  Fly   229 YEECAKAGIECA 240
            |    |.|:.|:
Zfish   225 Y----KVGVPCS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 44/167 (26%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 44/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585797
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.