DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and r3hdml

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001373427.1 Gene:r3hdml / 561976 ZFINID:ZDB-GENE-090313-275 Length:252 Species:Danio rerio


Alignment Length:204 Identity:50/204 - (24%)
Similarity:71/204 - (34%) Gaps:48/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRL 125
            |..||:..||.||       :::...|..|..|.|::.|.|.|...|..|:..|...|..:..  
Zfish    65 DMTALLDYHNRVR-------SQVFPPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHFLQHI-- 120

  Fly   126 SGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIG----HL 186
             ||||..:...:..|..             .|:.|..|....:         .|....|    |.
Zfish   121 -GQNLSIISGRYKSIID-------------LVKSWYDERHSFS---------YPSRCSGSVCTHY 162

  Fly   187 TVLINEKSNAVGCGLV----AYNLGEIRRYN--LACNYAYT-NVIGERVYEECAKAGIECAKGID 244
            |.::...||.:||.:.    .:..|.:.:..  |.||||.. |.:||..|    |.|..|: ...
Zfish   163 TQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPY----KIGRPCS-ACP 222

  Fly   245 QKYPPLCAK 253
            ..|...|.|
Zfish   223 SSYGGSCNK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 37/166 (22%)
r3hdmlNP_001373427.1 CAP_R3HDML 66..201 CDD:349409 37/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585755
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.