DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and pi15b

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:207 Identity:54/207 - (26%)
Similarity:81/207 - (39%) Gaps:41/207 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCL 111
            |.||......::..|..|::..||.||       |.:...|..|..|.|:..|.:.|...|.||:
Zfish    51 SKPKSRRKRYISQSDMIAILDYHNKVR-------ANVFPPAANMEYMLWDDGLARSAEAWAATCI 108

  Fly   112 MGHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTT 176
            ..|...:   ..|..||||.....::..|.:             .|:.|..|.:|......:...
Zfish   109 WEHGPPY---LLRYLGQNLSVRTGNYRSILQ-------------LVKPWYDEVRDYMFPYPRDCN 157

  Fly   177 PNPP-----EVIGHLTVLINEKSNAVGCGL-VAYNL---GEIRR---YNLACNYA-YTNVIGERV 228
            |:.|     .:..|.|.::...||.|||.: ..:|:   |.:.|   | |.|||: ..|.|||..
Zfish   158 PHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATY-LVCNYSPKGNWIGEAP 221

  Fly   229 YEECAKAGIECA 240
            |    :.|:.|:
Zfish   222 Y----RVGVPCS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 42/168 (25%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 42/166 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.