DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and Glipr1l3

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:206 Identity:46/206 - (22%)
Similarity:85/206 - (41%) Gaps:42/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SFGSSCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNA 107
            :||:..|:..:::.....|  |.:..||.:|:       |::..|..|.::.|::.|.|||....
Mouse    25 AFGNDLPRVPSILDPKFID--AFLNIHNELRR-------KVQPPAADMNQVIWDQKLAKLAKAWT 80

  Fly   108 KTCLMGHDECHNTE-----KFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDI 167
            :.|.:||:.|.:.:     .:...|:|:: :|             .:....|..|..|..|..|.
Mouse    81 RECKLGHNPCTSKQYGCLLDYDFIGENIY-LG-------------EIETQPEDVVNNWYNENTDY 131

  Fly   168 TAEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGLVAYNLGEIRRYN---LACNYAYT-NVIGERV 228
            ...|     ....::..:.|.|:..|:..:||.:  .|...:.||:   ..|||:.| |.:..|.
Mouse   132 NFVD-----NTCSKICRNYTQLVWAKTFKIGCAV--SNCPNLTRYSAGLFVCNYSPTGNFLDFRP 189

  Fly   229 Y---EECAKAG 236
            |   :.|:..|
Mouse   190 YRKGDPCSMCG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 35/164 (21%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 37/171 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.