DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:255 Identity:61/255 - (23%)
Similarity:96/255 - (37%) Gaps:73/255 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFVLSLVLHSLAENFCRQDLCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGD---KNALIKAH 69
            ||:.:|.|:.:|....:                  :||...|:..|:     .|   ||..:.:|
  Rat     8 IFLWTLALYLVASRLPK------------------AFGKVLPRVPTI-----NDPEFKNGFLNSH 49

  Fly    70 NLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHN-----TEKFRLSGQN 129
            |..|:       |::..|..|.::.|:|.|.|||....:.|...|:.|.:     |:.:...|:|
  Rat    50 NEARR-------KVQPPASNMNQLSWDKSLAKLAKSWTRECKFSHNPCTSKRHGCTKDYDYIGEN 107

  Fly   130 LFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKS 194
            :: :|...||.             |..|..|..|.||...:|...|     :..||.|.::..|:
  Rat   108 IY-LGKIDARP-------------EDVVFSWYNETKDYNFDDNTCT-----KTCGHYTQVVWAKT 153

  Fly   195 NAVGCG------LVAYNLGEIRRYNLACNYAYT-NVIGERVY---EECAKAG-IECAKGI 243
            ..:||.      |..|:.|     ...|||... |..|.:.|   |.|:..| .||...:
  Rat   154 LKIGCAISNCPHLTGYSAG-----LFVCNYVPAGNFQGSKPYIKGEPCSMCGEKECVNSL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 42/167 (25%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 43/171 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344781
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.