DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and crisp1.3

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001008204.1 Gene:crisp1.3 / 493566 XenbaseID:XB-GENE-951048 Length:240 Species:Xenopus tropicalis


Alignment Length:234 Identity:59/234 - (25%)
Similarity:88/234 - (37%) Gaps:47/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LCTKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHNLVRQKWASGKAKIKWTACKMA 91
            ||......:|.::.:..|.|....:.||.::       :|.|||..|:. ||..|:      .|.
 Frog     7 LCIAAFMALAVESADPPFSSISTDNVTVTQI-------IINAHNNYRRN-ASPSAR------NML 57

  Fly    92 KMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRL-----SGQNLFAMGFSHARITKTKMNMTLSM 151
            ||.||||    |.:||.:......|.|:....|.     .|:||:...:..:             
 Frog    58 KMVWNKD----AAINAASWAATCSESHSPSDKRTIPGFGCGENLYMASYPAS------------- 105

  Fly   152 LFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGLVAYNLGEIRRYNLAC 216
             :|.||:.|..|..|.......|   :|..|.||.|.::...|..|||. |:|......:|...|
 Frog   106 -WEEAVKGWYSEYNDFQYGVGPK---SPGLVTGHYTQVMWYNSYMVGCS-VSYCPKSPYKYFYVC 165

  Fly   217 NYAYTNVIGERV---YE---ECAKAGIECAKGIDQKYPP 249
            .|.....:...:   |:   :||.....|..|:...|.|
 Frog   166 QYCPAGNLDSTMSTPYKTGPKCADCPTACDNGLCTNYCP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 44/161 (27%)
crisp1.3NP_001008204.1 CAP_CRISP 33..170 CDD:349402 47/172 (27%)
Crisp 187..240 CDD:369954 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.