DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG8483

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster


Alignment Length:201 Identity:54/201 - (26%)
Similarity:90/201 - (44%) Gaps:31/201 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DKNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRL 125
            :::.:::.||.:||..|:|:...:..|..|.::.|:.:|...|...|..|...||......:|.:
  Fly    36 ERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTM 100

  Fly   126 SGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDL--KKTTPNPPEVIGHLTV 188
             |||| |:.:|.|.:.....:      |...:|.|..|.:..:..|.  .||        ||.:.
  Fly   101 -GQNL-AIIWSTAPLDADDGD------FPSRIQSWFNEVQKYSFGDAWSPKT--------GHYSQ 149

  Fly   189 LINEKSNAVGCGLVAYNLGEIRRYN--LACNYA-YTNVIGERVYE----ECAKAGIECAKGIDQK 246
            |:..:::.||||...|.  :..:||  ..|||. ..||:|...||    .|:..|::.:    .:
  Fly   150 LVWGETSLVGCGYAEYK--DTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYGMKPS----SR 208

  Fly   247 YPPLCA 252
            |..|||
  Fly   209 YQGLCA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 42/160 (26%)
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 42/160 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455050
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102857at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.