DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42780 and CG11977

DIOPT Version :9

Sequence 1:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:206 Identity:48/206 - (23%)
Similarity:83/206 - (40%) Gaps:35/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NFCRQDLCTKGTTHIACQNVNGSFGSS-CPKDATVIKLNLGDKNALIKAHNLVRQK--WASGKAK 82
            ::|..|:|.....||.|   ...|.|: |.::...:::: ..:..:::..|..|:|  |..|...
  Fly    43 DYCNADICPANKKHITC---GFKFWSTKCGRNHEGVRMS-DYRYDIVRNVNNFRRKLEWGLGNLP 103

  Fly    83 IKWTACKMAKMEWNKDLEKLAILNAKTCLMGH--DECHNTEKFRLSGQNLFAMGFSHARITKTKM 145
               .|.|...::|:.:|..:|:..:..||. |  ..|.||..::..|:   :..|...:.|....
  Fly   104 ---RAVKFKNIKWDDELSVMAMRVSNQCLQ-HTFSPCVNTFLYKDVGE---SSDFVKVQNTSKGF 161

  Fly   146 NMT--LSMLFE---MAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGLVAYN 205
            |:.  |:|.||   |....:.....:|..:|......|          ||.||:..:|||:|...
  Fly   162 NVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFAN----------LIYEKNKKMGCGMVKSG 216

  Fly   206 LGEIRRYNLAC 216
            .|..    |.|
  Fly   217 QGRF----LTC 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 39/164 (24%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.